PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_08593.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 337aa    MW: 37436.9 Da    PI: 6.262
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_08593.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.47e-181461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd +lv +++++G+g+W++++   g++R+ k+c++rw +yl
  Rsa1.0_08593.1_g00001.1 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTNTGLRRCSKSCRLRWTNYL 61
                             79********************************************97 PP

2Myb_DNA-binding49.78.5e-1667112148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg++T+ E++ +v++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Rsa1.0_08593.1_g00001.1  67 RGNFTEHEEKMIVHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
                              89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-24564IPR009057Homeodomain-like
PROSITE profilePS5129425.646965IPR017930Myb domain
SuperFamilySSF466892.46E-3012108IPR009057Homeodomain-like
SMARTSM007171.0E-141363IPR001005SANT/Myb domain
PfamPF002491.7E-161461IPR001005SANT/Myb domain
CDDcd001673.92E-111661No hitNo description
Gene3DG3DSA:1.10.10.602.0E-2465117IPR009057Homeodomain-like
SMARTSM007177.7E-1666114IPR001005SANT/Myb domain
PROSITE profilePS5129419.41266116IPR017930Myb domain
PfamPF002494.6E-1467112IPR001005SANT/Myb domain
CDDcd001674.42E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MGRPPCCEKT AVKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTNTGLRRCS KSCRLRWTNY  60
LRPGIKRGNF TEHEEKMIVH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKKKLKKIN  120
ESGQGDNDAF SSSNTVSQKQ HQSSNKGQWE KRLQTDINMA KQALCEALSL DKKPSSKLSP  180
SSSSLSIIPQ NIPGSSSATT TTITTTSNTT TQFLSGVYAS SAENIARLLQ DFMKDPPKTL  240
TLTSSSSPVS ETGPLVSAAT EEGGEGFEQS FFSFNSMEET QNLTQEESFF HDQVSKPEIT  300
MEQDSGLISQ GSLSLFEKWL FDENMVGMSL EGQEAMC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-261411627128MYB TRANSFORMING PROTEIN
1mse_C6e-26141164105C-Myb DNA-Binding Domain
1msf_C6e-26141164105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM9756620.0KM975662.1 Brassica napus MYB transcription factor 96-2.1 (MYB96-2.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013703567.10.0PREDICTED: myb-related protein 306-like
SwissprotP813921e-110MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A078DDF30.0A0A078DDF3_BRANA; BnaC09g05650D protein
STRINGBra029258.1-P0.0(Brassica rapa)
STRINGBra035893.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62470.21e-158myb domain protein 96